PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001155G0480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 246aa    MW: 25260.3 Da    PI: 10.0144
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001155G0480genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.42e-18143178136
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                      C++Cg+ kTp+WR gp g ktLCnaCG+++++ +l+
  PH01001155G0480 143 CTHCGSEKTPQWRTGPLGAKTLCNACGVRFKSGRLM 178
                      ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.5E-17137187IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.76E-14141201No hitNo description
PROSITE profilePS5011411.517141173IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-14141175IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.56E-13142189No hitNo description
PROSITE patternPS003440143168IPR000679Zinc finger, GATA-type
PfamPF003204.1E-16143178IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MCVIQSEEAA ELEWLSKFVD DSYSDIPNYS SAAHAAMAAA AAASAASNGG VNSAGQDSCI  60
TAALGRGARS KRSRATAAAA AARHSLVPLP PSQSSPSSSC SSSDFPSSKP ARPNGSIGSR  120
GKKSPGAGGP AGDVGIEGGV RRCTHCGSEK TPQWRTGPLG AKTLCNACGV RFKSGRLMPE  180
YRPAASPTFV LTQHSNSHRK VMELRRQKEL ILIRGSHRDA AAAAAAAGSA GSTGRPELMF  240
RDYGVC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0979370.0FP097937.1 Phyllostachys edulis cDNA clone: bphylf030f10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983678.11e-104PREDICTED: GATA transcription factor 2-like
SwissprotO497413e-54GATA2_ARATH; GATA transcription factor 2
TrEMBLK4ABL61e-104K4ABL6_SETIT; Uncharacterized protein
STRINGSi036273m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-45GATA transcription factor 2